PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025963-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 340aa    MW: 38578.5 Da    PI: 4.9487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025963-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
    NNU_025963-RA 16 KGPWTPAEDMKLIAFIQRHGHENWRALPKQAGLLRCGKSCRLRWTNYL 63
                     79******************************99************97 PP

2Myb_DNA-binding56.94.6e-1869114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e++++++++lG++ W++Ia++++ gRt++++k+ w+++l
    NNU_025963-RA  69 RGNFTVEEEEIIIKLHELLGNK-WSKIASHLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-24766IPR009057Homeodomain-like
PROSITE profilePS5129413.7721163IPR017930Myb domain
SuperFamilySSF466898.8E-3113110IPR009057Homeodomain-like
SMARTSM007174.3E-131565IPR001005SANT/Myb domain
PfamPF002491.6E-141663IPR001005SANT/Myb domain
CDDcd001672.30E-91863No hitNo description
PROSITE profilePS5129427.50764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2767118IPR009057Homeodomain-like
SMARTSM007171.2E-1668116IPR001005SANT/Myb domain
PfamPF002492.0E-1669114IPR001005SANT/Myb domain
CDDcd001672.17E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRGRTPCCD KTGLKKGPWT PAEDMKLIAF IQRHGHENWR ALPKQAGLLR CGKSCRLRWT  60
NYLRPDIKRG NFTVEEEEII IKLHELLGNK WSKIASHLPG RTDNEIKNVW NTHLKKRLVP  120
KAPKILEELV EKQGPPVEVS PTEWKKDVLD ALLDDKIGIE IENRMVQEVD RSRDECQKLS  180
PSTSSSSCGS CVSDSNQIDA SGREGQAYPQ SESGGRLCET QSTLQEVNKN EQTEERLEIP  240
FEPNLDFWEV FDDYPCLLTS SVPMCGVESN QHSEGCKKEV ESMRWVSYLE NELGLHETTE  300
EVFQPQVSNS SCEEILLKTE VDPVATYFQM SPSSPLNFGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141185108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247284.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A061FB531e-90A0A061FB53_THECC; Myb domain protein 58 isoform 1
STRINGPOPTR_0007s08190.13e-82(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.16e-63myb domain protein 63